PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g055470.2.1
Common NameLOC101265827
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 545aa    MW: 60763.6 Da    PI: 4.427
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g055470.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.88.5e-53101371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         ++pGfrFhPtdeelv +yL++kv gk+l++ ++i+e+diykvePwdLp  +++k+++ ewyfFs  d+k+ +g ++nrat++gyWk+tgkd
  Solyc05g055470.2.1  10 MAPGFRFHPTDEELVRYYLRRKVIGKPLRF-DAISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSVLDRKHGNGAKTNRATERGYWKTTGKD 99 
                         579*************************99.99***************6347788888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v++ k+++vg+kktLvf++grapkge+t+Wvmhey+l
  Solyc05g055470.2.1 100 RAVHH-KSKVVGMKKTLVFHSGRAPKGERTNWVMHEYKL 137
                         *****.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-6210160IPR003441NAC domain
PROSITE profilePS5100558.14410160IPR003441NAC domain
PfamPF023656.0E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MESKGSAKWM APGFRFHPTD EELVRYYLRR KVIGKPLRFD AISEIDIYKV EPWDLPGMSR  60
LKTRDLEWYF FSVLDRKHGN GAKTNRATER GYWKTTGKDR AVHHKSKVVG MKKTLVFHSG  120
RAPKGERTNW VMHEYKLIDE ELQKAGIVQD ALVLCRVFQK SGAGPKNGEK YGAPFVEEEW  180
EDDELEIVPK EEAAEEVEFG DDIYLDGHDL EEILGADSPV DGAPHPLNCY SEGNASNSGE  240
TSNSFEEAQN WLQQPDEQES FDPAIQQINA DTNPVKHEFM SEPSNSMSTE DVDYLLDEPV  300
ITATDNLQFS DGAFLEASDL SRPIEVDTSG FDMLEDYLAF FDADDNFQSM GFNPPMMTGD  360
DDHVSDLASV EEKNIAEVND QPIAPSEEPD DQKKNVASSS KLEPSKFGSD YKYPFMKQTS  420
CMLGGIPAPP AFASEFPSKN AALRMNSSSE ASSSIHVTGF IRITNMTVSS NGMDGLVGKH  480
GNYNVILSLG LSQHGDSSAH LESEASFLPG KTISTVSWCW FYYLFLWVLL LSTTFKIGTF  540
IRAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-451016620174NAC domain-containing protein 19
3swm_B1e-451016620174NAC domain-containing protein 19
3swm_C1e-451016620174NAC domain-containing protein 19
3swm_D1e-451016620174NAC domain-containing protein 19
3swp_A1e-451016620174NAC domain-containing protein 19
3swp_B1e-451016620174NAC domain-containing protein 19
3swp_C1e-451016620174NAC domain-containing protein 19
3swp_D1e-451016620174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.258970.0leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239710.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLK4C2M30.0K4C2M3_SOLLC; Uncharacterized protein
STRINGSolyc05g055470.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Representative plantOGRP1057159
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-128NAC domain containing protein 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]